PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.005G173300.1
Common NameB456_005G173300, LOC105794555
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 574aa    MW: 64343.8 Da    PI: 4.9483
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.005G173300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like78.58.2e-25202255155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r++Wt +LH++Fv+av+q+ G +k  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Gorai.005G173300.1 202 KARVVWTVDLHQKFVKAVNQI-GFDKVGPKKILDLMNVPWLTRENVASHLQKYRL 255
                         68*******************.9*******************************8 PP

2Response_reg83.37.2e-28221301109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+vdD+p+ +++l+++l+k  y ev+++  ++eal+ll+e++  +D+++ D++mp+mdG++ll++   e  +lp+i+++  ge + + + 
  Gorai.005G173300.1  22 VLVVDDDPTWLKILEKMLKKCSY-EVTTCCLAREALNLLRERKdgYDIVISDVNMPDMDGFKLLEHVGLEM-DLPVIMMSVDGETSRVMKG 110
                         89*********************.***************999999**********************6644.8****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         ++ Ga d+l Kp+ ++el++
  Gorai.005G173300.1 111 VQHGACDYLLKPIRMKELRN 130
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521727.12E-3619144IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.5E-4419164No hitNo description
SMARTSM004481.4E-3220132IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.31221136IPR001789Signal transduction response regulator, receiver domain
PfamPF000726.8E-2522131IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.48E-2923136No hitNo description
SuperFamilySSF466895.2E-18200259IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28200260IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-22202255IPR006447Myb domain, plants
PfamPF002497.8E-8204254IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MVLAESGFSS PRNDAFPAGL RVLVVDDDPT WLKILEKMLK KCSYEVTTCC LAREALNLLR  60
ERKDGYDIVI SDVNMPDMDG FKLLEHVGLE MDLPVIMMSV DGETSRVMKG VQHGACDYLL  120
KPIRMKELRN IWQHVFRKKI HEVRDIESLE GFESIQMTRS GYDLFDDGHF LSGDDTTSGR  180
KRKDADNKHD DRELSDPSST KKARVVWTVD LHQKFVKAVN QIGFDKVGPK KILDLMNVPW  240
LTRENVASHL QKYRLYLSRL QKESDIKNSF IGMKHSDLPS KDSTASFGPH KAMNMIPDDV  300
PNGTYSFSAS NSLAQNVDLK GQGDLKGITS APVAEPKGAL SIDIHDSHEA KSTQMSFDHS  360
LGSVDSAVSF ASFNSTTPLQ YPWTEIPEIQ FKQECEPLHL ENGFSQLPLP GPSMIENEAN  420
RSRIEVKPLL DECRSNFVEH LGPVGAEDLF PIQSKSQSLN NQVFDLISAT KSSMKTQDVG  480
LNYLADSEFA LRNLNASGVG VPLATLSEDL QICWLQGDCY PMNYGLQDLE CSTYDNPGLM  540
AETPFHLYDV LRFDHEHLFD PTEYYAIDQG LFA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-18198260163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5249203e-72HQ524920.1 Gossypium herbaceum clone NBRI_C_EYT27PB01BJGHL simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479245.10.0PREDICTED: two-component response regulator ARR11
SwissprotQ5N6V81e-148ORR26_ORYSJ; Two-component response regulator ORR26
TrEMBLA0A0D2SIT50.0A0A0D2SIT5_G
STRINGVIT_01s0010g02230.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80662740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-136response regulator 11
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]